Chum salmon fillet, portion, B/P block, scrapemeat block 13+, 11- Latin name: Oncorhynchus keta/gorbuscha Fillet Size: 400-800g, 800g+ Portion size: 80-100, 100-120, 120-140, 140-160f skin-on, or skinless, or defatted. Package: bulk, retail bag, IVP bag. Common Name:Chum Salmon Scientific Name:Oncorhynchus keta Market Name(s):Keta salmon, Dog salmon, Chub, Calico salmon Chum salmon: With a mild flavor and firm pink flesh, keta salmon are a great choice for grilling or roasting. Chum salmon can be the best value on the market when the skin is bright and the meat deep red, according to some buyers. Since most chum salmon spawns near river mouths, they have lower oil content than sockeye, Chinook, or coho. Chum salmon has a mild taste, is low in sodium, and is a good source of omega-3 fatty acids, niacin, vitamin B12, and selenium. Chum is graded 2-4, 4-6, 6-9, and 9 up and is readily available fresh and frozen, both H&G and fillets, but may also be canned or smoked. Like other kinds of salmon, chum quality differs greatly depending on the run. Buyers recommend learning about specific runs and their characteristics in order to identify the best salmon. The eggs are sold as ikura in Japan, where they have a high value.
IQF, skin on, boneless, PBO, Trim C, max twice frozen Chemical treated, Max moisture:79.5% Color 13+ size before glaze:200--300g 100% net weight, around 4% protective glaze compensated Packing: IVP, two IVP fillets in a 500g printed bag, 5kg master carton
Smile Fish: Crispy Salmon skin is a healthy and delicious snack. It is made by imported Salmon premium skin from Norway. We use the highest technology and quality to produce this product. It is very crispy and has no fat. There are many favours you can choose from such as Salty Egg, Tom Yum, Mala, Nori Seaweed and Sweet Corn. There are no Monosodium Glutamate (MSG). It is Halal Certified and approved from the Food and Drug Administration (FDA).
Pangasius, basa, shrimp, prawn, catfish, tilapia, tuna, seafood, mackerel, sardine, vannamei, black tiger, scampi, lobster, apple, meat, frozen, fish, juice, coconut, chili, banana, vegetable, can, canned, tin, pineapple, lime, dried, dry, dehydrated, cassava, taro, jackfruit, durian, tomato, corn, sauce, leave, whole, spice, herb, banana, oil, powder, flour, black, puree, concentrate, salmon, red, pea, passion, orange, panga, swai, fresh, freshwater, river, natural, cut, process, produce, chicken, beef, buffalo, quail, rice, pepper, cashew, turmeric, ginger, garlic, cinnamon, cassia, star, anise, cloves, nutmeg, fennel, ground, mince.
Name:Calcitonin Acetate(Salmon) Cas No: 47931-85-1(net) Formula: C145H240N44O48S2 Molecular: 3431.85 Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP Purity:98% Appearance: white powder Source: synthetic Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Chum Salmon (Oncorhynchus Keta), Frozen/HG Size: 4-6 lb / 6-9 lb / 9+ lb Description:Net Caught. Headed and Gutted / IQF / packed in pallet size totes of approximately 1200 lbs/ each. Good Meat Color with 10-15% of Pale Meat Color Origin: Alaska, USA Quantity: Approximately 126,000 lbs 21 totes of 4-6 lb 71 totes of 6-9 lb 14 totes of 9+ lb
Pink Salmon Ikura/Roe (Oncorhynchus Gorbuscha), Raw / Frozen Pack : 12 x 1 kilogram packs per 12 lb Master Box Origin : Alaska, USA Grade : Hardshell Production Dates : August and September 2017 Quantity : 10,000 kilograms
Pink Salmon Ikura/Roe (Oncorhynchus Gorbuscha), Raw / Frozen Pack: 12 x 1 kilogram packs per 12 lb Master Box Origin: Alaska, USA Grade: Hardshell Production Dates: August and September 2017 Quantity: 10,000 kilograms
1.Product: Chum salmon fillets/portion 2.Latin name: Oncorhynchus Keta 3.IQF,skinon or skinless,boneless,PBO, color:11-13 4.Size:80-200g or 200-500g 5.Packing: 1*10kg or bulk pack
a. Name of product : KRAX canned cat salmon b. Price of product : It depends on Order c. Product origin : All products Made in TURKEY d. Harmonization System (HS) Code : 230910900000 e. Minimum Order Size : 20 FEET container ( 10 pallets ) 70 packages on a pallet, so min Order is 700 package ( packege weight 15 kg) f. Packaging details : Only 15 kg packages with different flavors
a. Name of product : KRAX koepek canned salmon b. Price of product : It depends on Order c. Product origin : All products Made in TURKEY d. Harmonization System (HS) Code : 230910900000 e. Minimum Order Size : 20 FEET container ( 10 pallets ) 70 packages on a pallet, so min Order is 700 package ( packege weight 15 kg) f. Packaging details : Only 15 kg packages with different flavors
a. Name of product : OZZY canned cat salmon b. Price of product : It depends on Order c. Product origin : All products Made in TURKEY d. Harmonization System (HS) Code : 230910900000 e. Minimum Order Size : 20 FEET container ( 10 pallets ) 70 packages on a pallet, so min Order is 700 package ( packege weight 15 kg) f. Packaging details : Only 15 kg packages with different flavors
Product Description : Fresh/Frozen Price of product ( USD price or FOB price) USD 6-7 FOB Product origin : Norway Key Specifications/Special Features : Size 3/4/5/6/7 kg Minimum Order Size and Packgaing details : Packing ca 22kg /box Minimum Order Quantity20 feet container
Salmon is undeniably delicious. It has a unique, delicate flavor with a less "fishy" taste than many other fatty fish, such as sardines and mackerel. It is also extremely versatile. It can be steamed, sautéed, smoked, grilled, baked or poached. Salmon is rich in omega-3 fatty acids, loaded with selenium, good source of potassium, great source of protein and excellent in B vitamins. With our drying technology we can keep lots of goods after the process.
FROZEN ATLANTIC SALMON BELLY SIZE: 1-3&2-4CM PACKING: 10KG/CTN, BQF. 100% N.W.
Simm global is an agent from suppliers of sugar, yellow corn (human and animal), white corn, soybeans, wheat, barley, soybean meal, rice, wheat flour, edible oils, proteins such as chicken, beef, lamb, pork, urea, gold, fuels (en590 and others), woody pellets, orange juice and others..
LAYS Salmon Teriyaki 75 gr Origin : Indonesia Text : Mostly Indonesia, English Qty/Carton : 30 x 75 gr We encourage you to mix a lot of items inside one container. All orders will be quoted on competitive price, handled carefully and shipped as soon as possible.
LAYS Salmon Teriyaki 75 gr Origin : Indonesia Text : Mostly Indonesia, English Qty/Carton : 30 x 75 gr
Salmon.
Salmon.
